PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03273.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family M-type_MADS
Protein Properties Length: 155aa    MW: 17582 Da    PI: 5.0098
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03273.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.61.4e-121045237
                             ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEE CS
                   SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevav 37
                              i+++ +r +t+ kR+  + KK +ELS+LCd+++ v
  Sme2.5_03273.1_g00003.1 10 LIQDDKKRMTTLVKRKGSLVKKISELSILCDIKAFV 45
                             5899****************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-5159IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-13166IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.045161IPR002100Transcription factor, MADS-box
PfamPF003195.2E-111144IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGISKMRMEL IQDDKKRMTT LVKRKGSLVK KISELSILCD IKAFVKYPTW DSRFDYLSSE  60
ELQNLAGVLE KRMQNAKGRV EFLKSTKVED SNIGSSLSHD EIWDNDNLKQ STILPVNSFA  120
DYENFFQSNI PICGVDSVGV GTDNGLLSVD DYQFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755233e-32HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165481.14e-44PREDICTED: floral homeotic protein PISTILLATA-like
TrEMBLM1DA139e-44M1DA13_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000856763e-43(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26580.16e-08AGAMOUS-like-34